|
Medical Patent Abstract
Methods and compositions for medical imaging, evaluating intracellular
processes and components, radiotherapy of intracellular targets,
and drug delivery by the use of novel cell membrane-permeant peptide
conjugate coordination and covalent complexes having target cell
specificity are provided. Kits for conjugating radionuclides and
other metals to peptide coordination complexes are also provided.
Medical Patent Claims
What is claimed is:
1. A method for delivering a pharmacologically active substance
to a cell comprising, contacting the cell with an effective amount
of a compound comprising: a cell-membrane permeant peptide consisting
of a peptide sequence selected from the group consisting of SEQ
ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO:
34, SEQ ID NO: 35 and SEQ ID NO: 36; a pharmacologically active
substance; and a functional linker moiety linking the peptide and
the pharmacologically active substance; wherein said functional
linker moiety confers target cell specificity to the compound.
2. A method according to claim 1 wherein the pharmacologically
active substance is a compound selected from the group consisting
of: drugs, prodrugs, cytotoxic substances, enzymes, enzyme inhibitors,
and bioactive substances.
3. A method according to claim 1 wherein the pharmacologically
active substance is a drug selected from the group consisting of:
chemotherapeutics, anti-inflammatories, antibiotics, antifungal
agents, prostaglandins, steroids, anti-virals, monoclonal antibodies,
immune adjuvants, and therapeutic radionuclides.
4. A method according to claim 3 wherein the pharmacologically
active substance is a chemotherapeutic compound selected from the
group consisting of: vinblastine, doxorubicin, bleomycin, methotrexate,
5-fluorouricil, 6-thioguanine, cytarabine, cyclophosphamide, taxol,
taxotere, cis-platin, adriamycin, mitomycin, vincristine, UCN-01,
acivicin, 9-aminocamptothecin, azacitidine, bromodeoxyuridine, bryostatin,
carboplatin, dideoxyinosine, echinomycin, fazarabine, hepsulfam,
homoharringtonine, iododeoxyuridine, leucovorin, merbarone, misonidazole,
pentostatin, semustine, suramine, mephthalamidine, teroxirone, triciribine
phosphate and trimetrexate.
5. A method according to claim 3 wherein the pharmacologically
active substance is a chemotherapeutic compound selected from the
group consisting of: vinblastine, doxorubicin, bleomycin, methotrexate,
5-fluorouricil, 6-thioguanine, cytarabine, cyclophosphamide, taxol,
taxotere, cis-platin, adriamycin, mitomycin, and vincristine.
6. A method according to claim 3 wherein the pharmacologically
active substance is an anti-inflammatory selected from the group
consisting of: Celebrex, indomethacin, flurbiprofen, ketoprofen,
ibuprofen and phenylbutazone.
7. A method according to claim 3 wherein the pharmacologically
active substance is an antibiotic selected from the group consisting
of: beta-lactams, aminoglycosides, macrolides, tetracyclines, pryridonecarboxylic
acids and phosphomycin.
8. A method according to claim 2 wherein the pharmacologically
active substance is an amino acid.
9. A method according to claim 8 wherein the amino acid is selected
from the group consisting of: ascorbic acid and N-acetyltryptophan.
10. A method according to claim 2 wherein the bioactive substance
is a vitamin.
11. A method according to claim 2 wherein the pharmacologically
active substance is a bioactive substance selected from the group
consisting of: ribozymes, granulocyte-stimulating factors, platelet-stimulating
factors, erythrocyte-stimulating factors, macrophage-colony stimulating
factors, interleukins, tumor necrosis factors, interferons, cytokines,
monoclonal antibodies, immune adjuvants, gene therapy vectors, and
growth factors.
12. A method according to claim 2 wherein the pharmacologically
active substance is a drug comprising an antiviral compound selected
from the group consisting of: AZT, DDI, acyclovir, gancyclovir,
idoxuridine, amantadine and vidarabine.
13. A method according to claim 2 wherein the pharmacologically
active substance is an enzyme selected from the group consisting
of: transferases, hydrolyses, isomerases, proteases, ligases, kinases,
oxidoreductases, esterases, phosphatases, glycosidases, and peptidases.
14. A method according to claim 2 wherein the pharmacologically
active substance is an enzyme inhibitor selected from the group
consisting of: leupeptin, chymostatin and pepstatin.
15. A method according to claim 2 wherein the pharmacologically
active substance is a therapeutic radionuclide selected from the
group consisting of: as I-123, I-125, I-130, I-131, I-133, Sc-47,
As-72, Se-72, Y-90, Y80, Pd-100, Rh-100m, Sb-119, Ba-128, Hg-197,
At-211, Bi-212, Pd-212, Pd-109, Cu-67, Br-75, Br-76, Br-77, C-11,
N-13, O-15, F-18, Pb-203, Pb-212, Bi-212, Cu-64, Ru-97, Rh-105,
Au-198, and Ag-199.
16. A method according to claim 1 wherein said compound further
comprises at least one D-amino acid.
17. A method according to claim 16 wherein the pharmacologically
active substance is a compound selected from the group consisting
of: drugs, prodrugs, cytotoxic substances, enzymes, enzyme inhibitors,
and bioactive substances.
18. A method according to claim 16 wherein the pharmacologically
active substance is a drug selected from the group consisting of:
chemotherapeutics, anti-inflammatories, antibiotics, antifungal
agents, prostaglandins, steroids, anti-virals, monoclonal antibodies,
immune adjuvants, and therapeutic radionuclides.
19. A method according to claim 18 wherein the pharmacologically
active substance is a chemotherapeutic compound selected from the
group consisting of: vinblastine, doxorubicin, bleomycin, methotrexate,
5-fluorouricil, 6-thioguanine, cytarabine, cyclophosphamide, taxol,
taxotere, cis-platin, adriamycin, mitomycin, vincristine, UCN-01,
acivicin, 9-aminocamptothecin, azacitidine, bromodeoxyuridine, bryostatin,
carboplatin, dideoxyinosine, echinomycin, fazarabine, hepsulfam,
homoharringtonine, iododeoxyuridine, leucovorin, merbarone, misonidazole,
pentostatin, semustine, suramine, mephthalamidine, teroxirone, triciribine
phosphate and trimetrexate.
20. A method according to claim 18 wherein the pharmacologically
active substance is a chemotherapeutic compound selected from the
group consisting of: vinblastine, doxorubicin, bleomycin, methotrexate,
5-fluorouricil, 6-thioguanine, cytarabine, cyclophosphamide, taxol,
taxotere, cis-platin, adriamycin, mitomycin, and vincristine.
21. A method according to claim 18 wherein the pharmacologically
active substance is an anti-inflammatory selected from the group
consisting of: Celebrex, indomethacin, flurbiprofen, ketoprofen,
ibuprofen and phenylbutazone.
22. A method according to claim 18 wherein the pharmacologically
active substance is an antibiotic selected from the group consisting
of: beta-lactams, aminoglycosides, macrolides, tetracyclines, pryridonecarboxylic
acids and phosphomycin.
23. A method according to claim 18 wherein the pharmacologically
active substance is an amino acid.
24. A method according to claim 23 wherein the amino acid is selected
from the group consisting of: ascorbic acid and N-acetyltryptophan.
25. A method according to claim 18 wherein the pharmacologically
active substance is a vitamin.
26. A method according to claim 18 wherein the pharmacologically
active substance is a bioactive substance selected from the group
consisting of: ribozymes, granulocyte-stimulating factors, platelet-stimulating
factors, erythrocyte-stimulating factors, macrophage-colony stimulating
factors, interleukins, tumor necrosis factors, interferons, cytokines,
monoclonal antibodies, immune adjuvants, gene therapy vectors, and
growth factors.
27. A method according to claim 18 wherein the pharmacologically
active substance is a drug comprising an antiviral compound selected
from the group consisting of: AZT, DDI, acyclovir, gancyclovir,
idoxuridine, amantadine and vidarabine.
28. A method according to claim 18 wherein the pharmacologically
active substance is an enzyme selected from the group consisting
of: transferases, hydrolyses, isomerases, proteases, ligases, kinases,
oxidoreductases, esterases, phosphatases, glycosidases, and peptidases.
29. A method according to claim 18 wherein the pharmacologically
active substance is an enzyme inhibitor selected from the group
consisting of: leupeptin, chymostatin and pepstatin.
30. A method according to claim 18 wherein the pharmacologically
active substance is a therapeutic radionuclide selected from the
group consisting of: as I-123, I-125, I-130, I-131, I-133, Sc-47,
As-72, Se-72, Y-90, Y-88, Pd-100, Rh-100m, Sb-119, Ba-128, Hg-197,
At-211, Bi-212, Pd-212, Pd-109, Cu-67, Br-75, Br-76, Br-77, C-11,
N-13, O-15, F-18, Pb-203, Pb-212, Bi-212, Cu-64, Ru-97, Rh-105,
Au-198, and Ag-199.
31. A method for delivering a pharmacologically active substance
to a target cell comprising: using a functional linker moiety to
link the pharmacologically active substance to a cell-membrane permeant
peptide to form a peptide conjugate, wherein the cell-membrane permeant
peptide consisting of a peptide sequence selected from the group
consisting of SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID
NO: 33, SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36; wherein
the functional linker moiety is target cell-specific; and contacting
the cell with an amount of the peptide conjugate.
32. A method according to claim 31 wherein the cell-membrane permeant
peptide comprises at least one D-amino acid.
33. A method according to claim 31 wherein the pharmacologically
active substance is selected from the group consisting of: drugs,
prodrugs, cytotoxic substances, enzymes, enzyme inhibitors, and
bioactive substances.
34. A method according to claim 31 wherein the pharmacologically
active substance is a drug selected from the group consisting of:
chemotherapeutics, anti-inflammatories, antibiotics, antifungal
agents, prostaglandins, steroids, anti-virals, monoclonal antibodies,
immune adjuvants, and therapeutic radionuclides.
35. A method according to claim 31 wherein the functional linker
moiety comprises one of: an enzyme, a ribozyme, a low molecular
weight peptide binding motif, a protein kinase consensus sequence,
a protein phosphatase consensus sequence, or a protease-reactive
sequence or a protease-specific sequence.
36. A method according to claim 31 wherein the functional linker
moiety comprises a protease-reactive sequence or a protease-specific
sequence, said method further comprising promoting release of the
pharmacologically active substance from the peptide conjugate into
the target cell through enzymatic action of the functional linker
moiety on the peptide conjugate.
37. A method for delivering a pharmacologically active substance
to a target cell comprising: using a functional linker moiety to
link the pharmacologically active substance to the amino-terminus
or the carboxy-terminus of a cell-membrane permeant peptide to form
a peptide conjugate, wherein the cell-membrane permeant peptide
consisting of a peptide sequence selected from the group consisting
of SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ
ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36; wherein the functional
linker moiety is target cell-specific; and contacting the cell with
an amount of the peptide conjugate.
38. A method according to claim 37 wherein the cell-membrane permeant
peptide comprises at least one D-amino acid.
39. A method according to claim 37 wherein the pharmacologically
active substance is a compound selected from the group consisting
of: drugs, prodrugs, cytotoxic substances, enzymes, enzyme inhibitors,
and bioactive substances.
40. A method according to claim 39 wherein the pharmacologically
active substance is a drug selected from the group consisting of:
chemotherapeutics, anti-inflammatories, antibiotics, antifungal
agents, prostaglandins, steroids, anti-virals, monoclonal antibodies,
immune adjuvants, and therapeutic radionuclides.
41. A method according to claim 37 comprising linking the pharmacologically
active substance to the carboxy-terminus of the D-amino acid-containing,
cell-membrane permeant peptide using an active ester of the pharmacologically
active substance in the presence of a dehydrating agent.
42. A method according to claim 41 wherein the active ester of
the pharmacologically active substance is a hemi-succinate ester
of a compound selected from the group consisting of: N-hydroxysuccinimide,
sulfo-N-hydroxy-succinimide, hydroxybenzotriazole, and p-nitrophenol.
43. A method according to claim 41 wherein the dehydration agent
is selected from the group consisting of: dicyclohexylcarbodiimide
(DCC), 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide (ECD), and
1-(3-dimethylaminopropyl)-3-ethylcarbodiimide methiodide (EDCI).
44. A method according to claim 1 for delivering a pharmacologically
active substance to a target cell in vivo, the method further comprising:
combining the compound with a pharmaceutically acceptable carrier
or diluent to form a pharmaceutical composition; and and contacting
the cell with the compound using a delivery route selected from
the group consisting of the following: oral, parenteral, inhalation,
rectal, intradermal, transdermal, and topical.
45. A method for delivering a pharmacologically active substance
to a cell comprising: contacting the cell with an effective amount
of a compound comprising: cell-membrane permeant peptide consisting
of a peptide sequence selected from the group consisting of SEQ
ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO:
34, SEQ ID NO: 35 and SEQ ID NO: 36; a pharmacologically active
substance; and a functional linker moiety linking the peptide and
the pharmacologically active substance; wherein said functional
linker moiety confers target cell specificity to the compound and
the cell membrane permeant peptide and the functional linker form
a peptide conjugate.
46. A method for delivering a pharmacologically active substance
to a cell comprising: contacting the cell with an effective amount
of a compound comprising: a cell-membrane permeant peptide with
at least one D-amino acid the cell-membrane permeant peptide consisting
of a peptide sequence selected from the group consisting of SEQ
ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO:
34, SEQ ID NO: 35 and SEQ ID NO: 36; a pharmacologically active
substance; and a functional linker moiety linking the peptide and
the pharmacologically active substance; wherein said functional
linker moiety confers target cell specificity to the compound and
the cell membrane permeant peptide and the functional linker form
a peptide conjugate.
47. A method for delivering a pharmacologically active substance
to a target cell comprising: using a functional linker moiety to
link the pharmacologically active substance to a cell-membrane permeant
peptide to form a peptide conjugate; and contacting the cell with
an amount of the peptide conjugate; wherein the functional linker
moiety is target cell-specific and the cell-membrane permeant peptide
consisting of a peptide sequence selected from the group consisting
of SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ
ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36.
48. A method for delivering a pharmacologically active substance
to a target cell comprising: using a functional linker moiety to
link the pharmacologically active substance to the amino-terminus
or the carboxy-terminus of a cell-membrane permeant peptide to form
a peptide conjugate; and contacting the cell with an amount of the
peptide conjugate; wherein the functional linker moiety is target
cell-specific and the cell-membrane permeant peptide consisting
of a peptide sequence selected from the group consisting of SEQ
ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO:
34, SEQ ID NO: 35 and SEQ ID NO: 36.
49. A method for delivering a pharmacologically active substance
to a target cell comprising: using a functional linker moiety to
link the pharmacologically active substance to a cell-membrane permeant
peptide to form a peptide conjugate, wherein the functional linker
moiety is target cell-specific and the cell-membrane permeant peptide
consisting a peptide sequence selected from the group consisting
of SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ
ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36; and contacting the cell
with an amount of the peptide conjugate.
50. A method for delivering a pharmacologically active substance
to a target cell comprising: using a functional linker moiety to
link the pharmacologically active substance to the amino-terminus
or the carboxy-terminus of a cell-membrane permeant peptide to form
a peptide conjugate, wherein the functional linker moiety is target
cell-specific and cell-membrane permeant peptide consisting of a
peptide sequence selected from the group consisting of SEQ ID NO:
30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34,
SEQ ID NO: 35 and SEQ ID NO: 36.; and contacting the cell with an
amount of the peptide conjugate.
Medical Patent Description
BACKGROUND OF THE INVENTION
1. Field of the Invention
The present invention broadly relates to the field of medicine.
More specifically, the present invention relates to the fields of
medical imaging, diagnostics, and pharmaceutical therapy. The present
invention provides methods and compositions for medical imaging,
evaluating intracellular processes, radiotherapy of intracellular
targets, and drug delivery by the use of novel cell membrane-permeant
peptide conjugate coordination and covalent complexes having target
cell specificity. The present invention also provides kits for conjugating
radionuclides and other metals to the peptide coordination complexes.
2. Description of Related Art
Radiopharmaceuticals in Diagnosis and Therapy
Radiopharmaceuticals provide vital information that aids in the
diagnosis and therapy of a variety of medical diseases (Hom and
Katzenellenbogen, Nucl. Med. Biol. 24:485-498, 1997). Data on tissue
shape, function, and localization within the body are relayed by
use of one of the various radionuclides, which can be either free
chemical species, such as the gas .sup.133Xe or the ions .sup.123I.sup.-,
and .sup.201Tl.sup.-, covalently or coordinately bound as part of
a larger organic or inorganic moiety, the images being generated
by the distribution of radioactive decay of the nuclide. Radionuclides
that are most useful for medical imaging include .sup.11C (t.sub.1/2
20.3 min), .sup.13N (t.sub.1/2 9.97 min), .sup.15O (t.sub.1/2 2.03
min), .sup.18F (t.sub.1/2 109.7 min), .sup.64Cu (t.sub.1/2 12 h),
.sup.68Ga (t.sub.1/2 68 min) for positron emission tomography (PET)
and .sup.67Ga (t.sub.1/2 68 min), .sup.99mTc (t.sub.1/2 6 h), .sup.123I
(t.sub.1/2 13 h) and .sup.201Tl (t.sub.1/2 73.5 h) for single photon
emission computed tomography (SPECT) (Hom and Katzenellenbogen,
Nucl. Med. Biol. 24:485-498, 1997).
SPECT and PET imaging provide accurate data on radionuclide distribution
at the desired target tissue by detection of the gamma photons that
result from radionuclide decay. The high degree of spatial resolution
of modern commercial SPECT and PET scanners enables images to be
generated that map the radionuclide decay events into an image that
reflects the distribution of the agent in the body. These images
thus contain anatomic and functional information useful in medical
diagnosis. Similarly, if the radionuclides decay in such a manner
as to deposit radiation energy in or near the target cells or tissues,
the same approach would enable therapeutically relevant doses of
radioactivity to be deposited within the tissues.
Many radiopharmaceuticals have been prepared whose tissue localizing
characteristics depend on their overall size, charge, or physical
state (Hom and Katzenellenbogen, Nucl. Med. Biol. 24:485-498, 1997).
Other radiopharmaceuticals are synthesized with the intention to
be ligands for specific hormone, neurotransmitter, cell surface
or drug receptors, as well as specific high affinity transport systems
or enzymes. As these receptors and enzymes are known to be involved
in the regulation of a wide variety of vital bodily functions, effective
imaging agents can be used in the diagnosis or staging of a variety
of disease states, in which such receptors are functioning abnormally
or are distributed in an abnormal fashion, or in the monitoring
of therapy (Hom and Katzenellenbogen, Nucl. Med. Biol. 24:485-498,
1997). Effective therapeutic agents can also be used to deliver
pharmacologically active doses of compounds to the same receptors
and enzymes.
Recent advances in molecular, structural and computational biology
have begun to provide insights in the structure of receptors and
enzymes that should be considered in the design of various ligands.
Two key issues derived from the structure and distribution of these
receptors have a direct impact on the development of new radiopharmaceuticals:
1) the location of a receptor or enzyme activity in the body (i.e.,
peripheral sites versus brain sites), and 2) its subcellular location
(i.e., on the cell surface versus intracellular) will determine
whether a radiopharmaceutical injected intravenously will need to
traverse zero, one, two or more membrane barriers to reach the target.
The structure of the receptor and the nature of its interaction
with the ligand will determine the degree to which large ligands
or ligands with large substituents may be tolerated (Hom and Katzenellenbogen,
Nucl. Med. Biol. 24:485-498, 1997). For example, radiopharmaceuticals
which target cell surface receptors will encounter no membrane barriers
to reach their target. Natural ligands for these receptors can be
large, and often are charged and, consequently, large radiopharmaceuticals
are tolerated. Conversely, for a radiopharmaceutical to reach intracellular
receptors or enzymes, at least one membrane barrier, the cell plasma
membrane, must be traversed, and if the target site is within the
central nervous system, the radiopharmaceutical must also traverse
the plasma membranes of endothelial cells of the brain which constitute
the blood-brain barrier. Such a situation usually favors radiopharmaceutical
designs that strongly minimize ligand size and molecular weight
(Hom and Katzenellenbogen, Nucl. Med. Biol. 24:485-498, 1997). Thus,
as the number of membrane barriers increases, a premium is placed
on keeping the size of a conventional radiopharmaceutical small
(<600 Da) and the lipophilicity intermediate (characterized by
an octanol-water partition coefficient, log P.about.2) to enable
the agent to traverse membranes (Dishino, et al., J Nucl Med 24:
1030-1038, 1983; Papadopoulos, et al., Nucl Med Biol 20:101-104,
1993; Eckelman, Eur J Nucl Med 22:249-263, 1995). This has conventionally
precluded the use of peptide radiopharmaceuticals for intracellular
targets.
There has been a great deal of research into the development of
radiopharmaceuticals directed toward cell surface receptors whose
natural ligands are peptides. Tc-labeled peptides can span the spectrum
of size. The derivatizing group or chelation core of smaller peptides
has been reported to impact the in vitro binding and in vivo distribution
properties of these compounds (Babich and Fischman, Nucl Med Biol
22:25-30, 1995; Liu, et al., Bioconj Chem 7:196-202, 1996). For
larger peptides or proteins, the labeling process can usually occur
at one or more of several reactive sites, and thus, the final mixture
of compounds is less chemically defined. Thus, for larger proteins,
it is usually much less clear which of these sites, if any, might
be more favorable for receptor interaction and whether or not specific
labeling would increase biological activity of the agent (Hom and
Katzenellenbogen, Nucl. Med. Biol. 24:485-498, 1997).
It is known that low molecular weight peptides and antibody fragments
provide rapid tumor targeting and uniform distribution in tumor
tissues (Yokota et al., Cancer Res 53:3776-3783, 1993). While such
characteristics render low molecular weight peptides attractive
vehicles for the delivery of radioactivity to tumor tissues and
organs for both targeted imaging and radiotherapy, nonetheless problems
have been encountered. High and persistent localization of the radioactivity
is observed in the kidneys, which compromises tumor visualization
in the kidney region and limits therapeutic potential (Buijs, et
al., J Nucl Med 33:1113-1120, 1992; Baum, et al., Cancer (Phila)
73:896-899, 1994; Choi, et al., Cancer Res 55:5323-5329, 1995; Behr,
et al., J Nucl Med 36:430-441, 1995). As discussed by Arano, et
al. (Cancer Res 59:128-143, 1999), radiolabeled low molecular weight
peptides and antibody fragments would become much more useful for
targeted imaging and therapy if the renal radioactivity levels could
be reduced without impairing those in the target tissue. Previous
studies have indicated that radiolabeled low molecular weight peptides
and antibody fragments are likely resorbed by proximal tubules via
luminal endocytosis after glomerular filtration (Silberbagl, S.
Physiol Rev 68:811-1007, 1988). The long residence times of the
radiometabolites generated after lysosomal proteolysis of the radio
labeled fragments in renal cells were also reported to be responsible
for the persistent renal radioactivity levels (Choi, et al., Cancer
Res 55:5323-5329; Rogers, et al., Bioconjugate Chem 7:511-522, 1996).
There exists a continued need for peptide-based radiopharmaceuticals
that are rapidly cleared and target intracellular receptors or enzyme
activities.
Peptide-Based Metal Coordination Complexes
Small peptides can be readily prepared by automated solid phase
peptide synthesis (Merifield et al., Biochemistry 21:5020-5031,
1982; Houghten, Proc Natl Acad Sci USA 82:5131-5135, 1985; Lin,
et al., Biochemistry 27:5640-5645, 1988) using anyone of a number
of well known, commercially available automated synthesizers, such
as Applied Biosystems ABI 433A peptide synthesizer. Many combinations
of natural and non-natural amino acids and peptide sequence mimetics
(peptidomimetics) are possible, and selective engineering of favorable
target-binding and pharmacokinetic properties can be accomplished
with natural and unnatural peptides (Lister-James et al., Q. J:
Nucl. Med., 41:111-118, 1997). Peptidomimetics are unnatural biopolymers
that do not contain .alpha.-amino acids, but rather incorporate
backbone structures with hydrogen-bonding groups (such as urea),
chiral centers, side chain functionalities, and a sufficient degree
of conformational restriction to behave similar to, or mimic the
bioactivities of, a natural polypeptide. Peptide-based imaging agents
are also well known (Lister-James et al., Q. J: Nucl. Med., 41:111-118,
1997; Lister-James et al., J. Nucl. Med., 38:105-111, 1997), especially
those that incorporate Tc-99m as the radionuclide, the most commonly
used isotope in medical imaging.
The metallic character of Tc-99m requires that it be stabilized
by a chelation system to be coupled to an imaging agent. This chelator
may typically involve a multiple heteroatom coordination system,
or the formation of a non-labile organometallic species. There are
two broad strategies for binding metals for biological applications.
These are "the pendant approach" and "the integrated
approach," which have been recently reviewed by Katzenellenbogen
and colleagues (Horn and Katzenellenbogen, Nucl. Med. Biol., 24:485-498,
1997). The pendant (or conjugate) approach involves the strategic
placement of a Tc-99m-chelator-tether moiety at a site on the ligand
that will not hinder binding of the ligand to its high affinity
receptor. The integrated approach replaces a component of a known
high-affinity receptor ligand with the requisite Tc-99m chelator
such that there is a minimal change in the size, shape, structure,
and binding affinity of the resultant molecule. Applications involving
peptide-based imaging agents typically use the conjugate design,
whereby an appropriate metal chelating moiety is affixed to the
amino or carboxy terminus of the targeting peptide.
A variety of metal chelation systems have been developed for synthesis
of radioisotopic and magnetic resonance peptide-based imaging agents.
Peptide-based agents target extracellular or externally oriented
membrane bound receptors (Hom and Katzenellenbogen, Nucl. Med. Biol.,
24:485-498, 1997) because the charge, size, and pharmacokinetic
properties of typical peptide structures do not allow diffusion
across the lipid bilayer of the cell plasma membrane. This limitation
has prevented peptide metal chelates from reporting the functional
status or biological activity of intracellular receptors or enzymes
or other homeostatic activities and intracellular targets. Although
techniques and reagents for labeling antibodies and antibody fragments
with metal-chelates are well known in the art (Hom and Katzenellenbogen,
Nucl. Med. Biol., 24:485-498, 1997, and references therein), they
target extracellular or externally oriented cell surface receptors.
Tat Proteins and Peptides
Tat is an 86-amino acid protein involved in the replication of
human immunodeficiency virus type 1 (HIV-1). The HIV-1 Tat transactivation
protein is efficiently taken up by cells (Mann and Frankel, EMBO,
10:1733-1739, 1991; Vives et al., J. Virol., 68:3343-3353, 1994),
and low concentrations (nM) are sufficient to transactivate a reporter
gene expressed from the HIV-1 promoter (Mann and Frankel, EMBO,
10:1733-1739, 1991). Exogenous Tat protein is able to translocate
through the plasma membrane and reach the nucleus to transactivate
the viral genome (Frankel and Pabo, Cell 55:1189-1193, 1988; Ruben,
et al, J Virol 63:1-8, 1989; Garcia, et al., EMBO J 7:3143, 1988;
Jones, Genes Dev 11:2593-2599, 1997).
A region of the Tat protein centered on a cluster of basic amino
acids is responsible for this translocation activity (Vives et al.,
J Biol. Chem., 272:16010-16017, 1997). Tat peptide-mediated cellular
uptake and nuclear translocation have been demonstrated in several
systems (Vives, et al., J Biol Chem 272:16010-16017, 1997; Jones,
Genes Dev 11:2593-2599, 1997). Chemically coupling a Tat-derived
peptide (residues 37-72) to several proteins results in their internalization
in several cell lines or tissues (Fawell, et at, Proc Natl Acad
Sci USA 91:664-668, 1994; Anderson, et at, Biochem Biophys Res Commun
194:876-8884, 1993; Fahraeus, et al., Curr Biol 6:84-91, 1996; Nagahara,
et al, Nat Med 4:1449-1452, 1998). A synthetic peptide consisting
of the Tat basic amino acids 48-60 with a cysteine residue at the
C-terminus coupled to fluorescein maleimide translocates to the
cell nucleus as determined by fluorescence microscopy (Vives et
al., J. Biol. Chem., 272:16010-16017, 1997). In addition, a fusion
protein (Tat-NLS-.beta.-Gal) consisting of Tat amino acids 48-59
fused by their amino-terminus to .beta.-galactosidase amino acids
9-1023 translocates to the cell nucleus in an ATP-dependent, cytosolic
factor-independent manner (Efthymiadis et al., J. Biol. Chem., 273:1623-1628,
1998).
While the literature teaches that Tat peptide constructs and similar
membrane permeant peptides readily translocate into the cytosolic
and nuclear compartments of living cells, little is known regarding
the cellular retention characteristics over time once the permeant
peptide constructs are no longer in contact with the cell surface
from the extracellular fluid spaces. Furthermore, no information
is available regarding the pharmacokinetic and distribution characteristics
of membrane-permeant peptides within a whole living organism, animal
or human.
Apoptosis
Chemotherapeutic drugs used in the treatment of cancer are thought
to interact with diverse cellular targets in conferring lethal effects
on mammalian cells. Recently, anticancer agents, irrespective of
their intracellular target, have been shown to exert their biological
effect in target cells by triggering a common final death pathway
known as apoptosis (Fulda, et al., Cancer Res 57:3823-3829, 1997;
Fisher, Cell 78:539-542, 1994). Thus, there exists mounting evidence
that many anticancer treatments may kill through apoptosis by activating
intracellular death machinery in the target cell rather than by
simply crippling various components of cellular metabolism (Fulda,
et al., Cancer Res 57:3823-3829, 1997; Fisher, Cell 78:539-542,
1994). In fact, the action of ionizing radiation, drug therapy,
and withdrawal of physiological survival factors all appear to act
as death stimuli in promoting execution of this common apoptotic
pathway (Evan and Littlewood, Science 281:1317-1322, 1998; Ashkenazi
and Dixit, Science 281:1305-1308, 1998). Thus, new models of resistance
to therapy have begun to focus on mechanisms that antagonize execution
of the apoptotic pathway.
Apoptotic stimuli can arise from the nucleus, cell membrane surface,
or the mitochondria (Wyllie, Nature, 389:237-38, 1997). Ultimately,
the stimuli converge on a process of activation of a family of interleukin
1.beta.-converting enzymes {(ICE)-like cysteine proteases} known
as cysteine aspartases ("caspases") (Thornberry et al.,
Science, 281:1312-16, 1998). Members of the caspase family are activated
in apoptosis and have been shown to be necessary for programmed
cell death in a number of biological systems (Yuan et al., Cell,
75:641-52, 1993; Thornberry et al., Science, 281:1312-16, 1998).
The caspase gene family, defined by sequence homology, is also characterized
by conservation of key catalytic and substrate-recognition amino
acids (Talanian et al., J. Biol. Chem., 272:9677-82, 1997). Thirteen
mammalian caspases (1 through 13) have thus far been isolated, having
distinct roles in apoptosis and inflammation (Thornberry et al.,
Science, 281:1312-16, 1998). In apoptosis, some caspases are involved
in upstream regulatory events and are known as "initiators,"
while others are directly responsible for proteolytic cleavages
that lead to cell disassembly and are known as "effectors."
Evidence indicates that caspases transduce or amplify signals by
mutual activation. For example, Fas-induced apoptosis is characterized
by an early, transient caspase-1-like protease activity followed
by a caspase-3-like activity, suggesting an ordered activation cascade
(Enari et al., Nature, 380:723-26, 1996). Other data suggest that
both caspase-3 and caspase-7 are activated by caspase-6 and caspase-10
(Thornberry et al., Science, 281:1312-16, 199; Fernandes-Alnemri,
Proc. Natl. Acad. Sci. USA, 93:7464-69, 1996). Thus, while the activation
cascade hypothesis remains to be absolutely proven (Villa et al.,
Trends in Biochem. Sci., 22:388-93, 1997), circumstantial evidence
strongly points to caspase-3 as one key "effector" caspase,
standing at the center of the execution pathway of the cell death
program.
Caspases are some of the most specific of the proteases, showing
an absolute requirement for cleavage after aspartic acid (Thornberry
et al., Science, 281:1312-16, 1998). Recognition of at least four
amino acids, amino terminal to the cleavage site, is also necessary
for efficient catalysis. The preferred recognition motif differs
significantly between caspases, thereby contributing to their biologically
diverse functions (Talanina et al., J. Biol. Chem. 272:9677-82,
1997). In addition to high specificity, caspases are also highly
efficient, with K.sub.cat/K.sub.m values>10.sup.6 M.sup.-1s.sup.-1
(Thornberry et al., Science, 281:1312-16, 1998). When viewed from
the perspective of a molecular target for oncological imaging, this
is a key property of the caspases that allows detection of caspase
activity in vivo by radiosubstrates. Another advantage of the caspases
as imaging targets centers on the nature of the biochemical reaction.
Because normal cells have essentially non-detectable levels of caspase
activity, and once activated, the "caspase cascade" amplifies
reaction rates to maximal velocities (Thornberry et al., Science,
281:1312-16, 1998), the signal readout obtained by imaging is binary
in character. That is, in the absence of caspase activity, the imaging
signal will be low, and when activated, a highly amplified imaging
signal will result. This renders the caspase-mediated enzymatic
reaction essentially zero-order in situ and, therefore, independent
of radiotracer concentration or specific activity, thus eliminating
the complexities of first or higher order reaction rates.
Deregulation of apoptosis resulting in insufficient cell death
can occur in cancer, allowing malignant tissues to grow (Thornberry
et al., Science, 281:1312-16, 1998). Conversely, some diseases involve
excess apoptosis, such as neurodegenerative disease, ischemia-reperfusion,
graft-vs-host disease, and autoimmune disorders (Thornberry et al.,
Science, 281: 1312-16, 1998). Accordingly, two-fold strategies for
therapeutic intervention are actively underway within the pharmaceutical
industry, one to selectively induce apoptosis through caspase activation,
the other to inhibit caspase activity. In order to assess the treatments
to alter apoptosis, an accurate means to assess apoptoic activity
in vivo is needed.
Inactive pro-caspases are constitutively expressed as pro-enzymes
in nearly all cells, existing in latent forms in the cell cytoplasm
(Villa et al., Trends in Biochem. Sci. 22:388-93, 1997). Thus, while
caspase-3 can be readily identified by Western blots, this requires
biopsy material and lysis of the cells. Furthermore, activation
of caspase-3 is only inferred by observation of lower molecular
weight cleavage fragments on the blot. Activation of caspase-3 has
also been inferred from nuclear shifts of antigen by immunohistochemical
analysis of biopsy material and shown to be associated with a more
favorable prognosis in, for example, pediatric neuroblastoma (Nakagawara
et al., Cancer Res. 57:4578-84, 1997). However, these indirect methods
only imply activation. Thus, the simple determination of the presence
or absence of caspase proteins is not necessarily diagnostically
useful. A method to directly and non-invasively detect and quantify
the enzymatic activity of caspases in order to monitor the commitment
to cell death pathway is needed. Because caspases are cytosolic
enzymes, new diagnostic and therapeutic compounds are required that
can readily cross cell membranes, and whose specificity is based
on the presence of protease activity.
Tat Peptide Complexes
Frankel et al. (U.S. Pat. Nos. 5,804,604; 5,747,641; 5,674,980;
5,670,617; 5,652,122) discloses the use of Tat peptides to transport
covalently linked biologically active cargo molecules into the cytoplasm
and nuclei of cells. Frankel only discloses covalently linked cargo
moieties, and does not teach or suggest the attachment of metals
to Tat peptides by metal coordination complexes. Specifically, Frankel
does not teach the use of peptide chelators to introduce radioimaging
materials into cells. In addition, while Frankel teaches the use
of cleavable coupling reagents between the Tat protein and the cargo
molecule, the cleavable linkers disclosed are non-specific, such
that the retention of the cargo molecule is not limited to specific
cells.
Anderson et al. (U.S. Pat. Nos. 5,135,736 and 5,169,933) discloses
the use of covalently linked complexes (CLCs) to introduce molecules
into cells. CLCs comprise a targeting protein, preferably an antibody,
a cytotoxic agent, and an enhancing moiety. Specificity is imparted
to the CLC by means of the targeting protein, which binds to the
surface of the target cell. After binding, the CLC is taken into
the cell by endocytosis and released from the endosome into the
cytoplasm. In one embodiment, Anderson discloses the use of the
Tat protein as part of the enhancing moiety to promote translocation
of the CLC from the endosome to the cytoplasm. In another embodiment,
Anderson discloses the use of CLCs to transport radionuclides useful
for imaging into cells. The complexes described by Anderson are
limited in their specificity to cells that can be identified by
cell surface markers. Many biologically and medically significant
cellular processes, for example caspase protease activities discussed
above, are not detectable with cell surface markers. In addition,
the attachment of enhancing moieties to the CLC is accomplished
by the use of bifunctional linkers. The use of bifunctional linkers
results in the production of a heterogeneous population of CLCs
with varying numbers of enhancing moieties attached at varying locations.
This can lead to the production of CLCs in which the biological
activity of the targeting protein, the enhancing moiety, or both,
are lost. Another disadvantage of CLCs is that the number and location
of linked enhancing moieties will vary with each reaction, so that
a consistent product is not produced.
There is a need in the art for cell membrane-permeant peptide complexes
of uniform composition, capable of delivering radionuclides, other
metals, diagnostic substances such as fluorochromes, dyes, etc.,
and therapeutic and cytotoxic drugs into cells in a specific and
selective manner. Furthermore, rapid clearance of the complexes
from non-target cells and tissues of the body would facilitate and
enhance the utility of such complexes in vivo.
SUMMARY OF THE INVENTION
The present inventor has surprisingly discovered that the addition
of D-amino acid containing membrane-permeant peptides attached to
non- or poorly permeant drugs, diagnostic and/or therapeutic substances
such as oligonucleotides, peptides, peptide nucleic acids, fluorochromes,
dyes, enzyme substrates, and metals useful in medical therapy, imaging,
and/or diagnostics greatly increases their accumulation within cells.
As shown in Example 14, this increase in accumulation is on the
order of 8- to 9-fold as compared to membrane-permeant peptides
comprising only naturally occurring L-amino acids. Thus, use of
the D-amino acid containing membrane-permeant peptides of the present
invention allows delivery of greater amounts of therapeutic or diagnostic
substances to the interior of cells either in vivo or in vitro than
was heretofore possible using membrane permeant peptides containing
only L-amino acids.
The present inventor has also discovered that the Tat peptide and
other cell membrane-permeant peptides can be used to selectively
deliver non- or poorly permeant drugs, diagnostic and/or therapeutic
substances such as oligonucleotides, peptides, peptide nucleic acids,
fluorochromes, dyes, enzyme substrates, and metals useful in medical
therapy, imaging, and/or diagnostics selectively to cells in vivo
only when functional linkers are introduced into the permeant peptide
construct, and has developed methods for linking these substances
to Tat and other peptides for use in such methods. As illustrated
in Examples 6 and 10, below, non-targeted Tat peptides, rather than
being trapped inside cells and tissues indefinitely, are cleared
surprisingly rapidly from body tissues when introduced into the
living organism. Furthermore, non-functionalized prototypes of such
complexes are rapidly excreted by the kidneys and cleared from the
whole body. Thus, membrane-permeant peptides covalently linked to
oligopeptides, proteins, oligonucleotides, and drugs as known previously
possess rapid and ineffective biological half-times within the whole
organism.
Thus, in response to this surprising and unanticipated property
of D-amino acid containing permeant peptides and to improve upon
the prior art, the present invention provides novel permeant peptide
conjugates, complexes and methods that possess the advantage of
enabling the targeted trapping of greater amounts of such compounds
or fragments thereof within desired cells, tissues and organs of
the intact body of living organisms. Conversely, when it is desired
to increase the rates of clearance of cargo oligopeptides, proteins,
oligonucleotides, metals, and drugs, the present invention also
provides methods that will enhance their rates of clearance from
the body.
Accordingly, in a first aspect, the present invention provides
a compound comprising a cell membrane-permeant peptide; a diagnostic
or pharmaceutically active substance; and a functional linker moiety
linking the peptide and the diagnostic or pharmaceutically active
substance, wherein the compound further comprises at least one D-amino
acid and the functional linker moiety confers target cell specificity
to the compound, or a pharmaceutically acceptable salt of the compound.
In a second aspect, the present invention provides a composition
comprising, a compound comprising a cell membrane-permeant peptide;
a diagnostic or pharmaceutically active substance; and a functional
linker moiety linking the peptide and the diagnostic or pharmaceutically
active substance, wherein the compound further comprises at least
one D-amino acid and the functional linker moiety confers target
cell specificity to the compound. The composition can further comprise
a pharmaceutically acceptable carrier, excipient, or diluent.
In a third aspect, the present invention provides a kit comprising,
a compound comprising a cell membrane-permeant peptide; a metal
chelation ligand; and a functional linker moiety linking the peptide
and the metal chelation ligand, wherein the compound further comprises
at least one D-amino acid and the functional linker moiety confers
target cell specificity to the compound, and a reducing agent capable
of reducing a metal that can be coordinately incorporated into the
metal chelation ligand.
In another aspect, the present invention provides a method for
imaging cells in vivo, comprising administering to an animal a cell
imaging effective amount of a compound comprising a cell membrane-permeant
peptide; a chelated radionuclide or a chelated relaxivity metal;
and a functional linker moiety linking the peptide and the chelated
radionuclide or the chelated relaxivity metal, the functional linker
confering target cell specificity to the compound, and monitoring
or evaluating the location of the radionuclide or relaxivity metal
within the animal. Further the compound may comprise at least one
D-amino acid.
In another aspect, the present invention provides a method for
imaging cells in vitro, comprising contacting the cells with a cell
imaging effective amount of a compound comprising a cell membrane-permeant
peptide; a diagnostic substance; and a functional linker moiety
linking the peptide and the diagnostic substance, wherein the functional
linker confers target cell specificity to the compound, and monitoring
or evaluating the presence of the diagnostic substance within the
cells. Further, the compound may comprise at least one D-amino acid.
In a further aspect, the present invention provides a method for
detecting cellular apoptosis in vivo, comprising administering to
an animal a cellular apoptosis detecting effective amount of a compound
comprising a cell membrane-permeant peptide; a diagnostic substance;
and a functional linker moiety linking the peptide and the diagnostic
substance, wherein the functional linker moiety comprises a caspase-reactive
sequence, and monitoring the diagnostic substance within the animal.
Further, the compound may contain at least one D-amino acid.
In another aspect, the present invention provides a method for
detecting cellular apoptosis in vitro, comprising contacting cells
or tissue in vitro with a cellular apoptosis detecting effective
amount of a compound comprising a cell membrane-permeant peptide;
a diagnostic substance; and a functional linker moiety linking the
peptide and the diagnostic substance, wherein the functional linker
moiety comprises a caspase-reactive sequence, and monitoring the
diagnostic substance within the cells or tissue. Further, the compound
may contain at least one D-amino acid.
In yet another aspect, the present invention provides a method
for detecting an enzyme in a cell, comprising contacting the cell
with an enzyme detecting effective amount of a compound comprising
a cell membrane-permeant peptide; a diagnostic substance; a functional
linker moiety linking the peptide and the diagnostic substance,
wherein the functional linker moiety comprises a sequence reactive
with the enzyme; removing unreacted compound from the locus of the
cell so that the signal to noise ratio is sufficient for diagnostic
purposes; and monitoring the presence of the diagnostic substance
in the cell. Such monitoring can be performed quantitatively, and
the cell can be present within a living animal. Furthermore, the
enzyme can be one that is characteristically associated with a disease,
condition, or disorder. Further, the compound may contain at least
one D-amino acid.
In yet another aspect, the present invention provides a method
for diagnosing the presence of a disease, condition, or disorder
in an animal, comprising administering to the animal a diagnostically
effective amount of a compound comprising a cell membrane-permeant
peptide; a diagnostic substance; a functional linker moiety linking
the peptide and the diagnostic substance, wherein the functional
linker moiety confers target cell specificity to the compound, and
which comprises a sequence reactive with an enzyme indicative or
characteristic of the disease, condition, or disorder, and monitoring
the diagnostic substance within the animal. By way of example, the
disease, condition, or disorder can be a cancer such as a central
nervous system tumor, breast cancer, liver cancer, lung cancer,
head cancer, neck cancer, a lymphoma, or a melanoma. Further, the
compound may contain at least one D-amino acid.
In still another aspect, the present invention provides a method
of assessing the effectiveness of cancer therapy, comprising administering
to an animal undergoing cancer therapy a diagnostically effective
amount of a compound comprising a cell membrane-permeant peptide;
a diagnostic substance; and a functional linker moiety linking the
peptide and the diagnostic substance, wherein the functional linker
moiety confers target cell specificity to the compound, and which
comprises a caspase-reactive sequence, and monitoring the diagnostic
substance within the animal. Such monitoring can be performed quantitatively.
Furthermore, the method can be repeated at intervals during the
cancer therapy, and the quantity of the diagnostic substance detected
within the animal at each interval can be compared to the quantity
of the diagnostic substance detected at previous intervals to determine
the effectiveness of the therapy. In addition, the compound may
contain at least one D-amino acid.
In yet another aspect, the present invention provides a method
of delivering a pharmaceutically active substance to a cell, comprising
contacting the cell with an effective amount of a compound comprising
a cell membrane-permeant peptide; a pharmaceutically active substance;
and a functional linker moiety linking the peptide and the pharmaceutically
active substance, wherein the compound further comprises at least
one D-amino acid and the functional linker moiety confers target
cell specificity to the compound.
In another aspect, the present invention provides a method of treating,
inhibiting, or preventing a disease, condition, or disorder responsive
to treatment with a pharmaceutically active substance in an animal,
comprising administering to the animal a pharmaceutically effective
amount of a compound comprising a cell membrane-permeant peptide;
a pharmaceutically active substance; and a functional linker moiety
linking the peptide and the pharmaceutically active substance, wherein
the compound further comprises at least one D-amino acid and the
functional linker moiety confers target cell specificity to the
compound.
In another aspect, the present invention provides a method for
selectively destroying cells expressing a selected enzyme activity,
comprising contacting the cells with a cell-destroying effective
amount of a compound comprising a cell membrane-permeant peptide;
a cytotoxic substance; and a functional linker moiety linking the
peptide and the cytotoxic substance, wherein the compound further
comprises at least one D-amino acid and the functional linker moiety
confers target cell specificity to the compound.
In yet another aspect, the present invention provides a method
for assessing the effect of a drug in altering the expression or
activity of an enzyme in a target cell, comprising contacting the
target cell with a diagnostically effective amount of a compound
comprising a cell membrane-permeant peptide; a diagnostic substance;
a functional linker moiety linking the peptide and the diagnostic
substance, wherein the functional linker moiety confers target cell
specificity to the compound, and which comprises a sequence capable
of interacting with the enzyme so as to release the diagnostic substance
from the compound into the interior of the cell; clearing unreacted
compound from the locus of the cell so that the signal to noise
ratio is sufficient for diagnostic purposes; and monitoring or evaluating
the diagnostic substance in the target cell. Such monitoring can
be performed quantitatively, and the target cell can be present
within a living animal. Furthermore, the enzyme can be associated
with a disease, condition, or disorder. In addition, the compound
may further comprise at least one D-amino acid.
In yet another aspect, the present invention provides a method
for detecting the expression of a nucleic acid sequence, which can
be DNA or RNA, encoding an enzyme, a receptor, or a binding protein
introduced into a cell, comprising contacting the cell with a compound
comprising a cell membrane-permeant peptide; a diagnostic substance;
a functional linker moiety linking the peptide and the diagnostic
substance, wherein the functional linker moiety confers target cell
specificity to the compound, and which comprises a sequence capable
of interacting with the enzyme, receptor, or binding protein so
as to selectively retain the diagnostic substance in the cell, and
monitoring the diagnostic substance in the cell. Further, the compound
may comprise at least one D-amino acid.
Further scope of the applicability of the present invention will
become apparent from the detailed description and drawings provided
below. However, it should be understood that the following detailed
description and examples, while indicating preferred embodiments
of the invention, are given by way of illustration only since various
changes and modifications within the spirit and scope of the invention
will become apparent to those skilled in the art from this detailed
description.
BRIEF DESCRIPTION OF THE DRAWINGS
The above and other objects, features, and advantages of the present
invention will be better understood from the following detailed
description taken in conjunction with the accompanying drawings,
all of which are given by way of illustration only, and are not
limitative of the present invention, in which:
FIG. 1 shows the general structure of a cell membrane-permeant
peptide coordination complex of the present invention.
FIG. 2 shows the proposed structure of an oxotechnetium-Tat-peptide
complex. The coordination metal (Tc.sup.vO) may be replaced by Re.sup.vO
to form essentially isostructural complexes.
FIG. 3 shows the time course of cellular uptake of a Tc-99m-Tat
peptide complex in human Jurkat cells. Extracellular concentration
of peptide was 950 nM. Each point represents the mean of 4 observations.+-.SEM
when larger than the symbol. Cell accumulation of the Tc-99m-Tat
peptide complex is 90% complete within 2 minutes and established
a quasi-steady state that was maintained for at least 1 hour (data
not shown).
FIG. 4 shows the concentration-dependence of plateau accumulation
of Tc-99m-Tat peptide conjugate into human Jurkat cells. Each point
represents the mean of 4 observations.+-.SEM when larger than the
symbol.
FIG. 5 shows washout kinetics of a non-functional Tc-99m-Tat peptide
complex from human Jurkat cells. Cells were loaded to plateau uptake
(.about.30 min), washed in ice cold buffer to clear extracellular
spaces, and then bathed in isotope-free buffer at 37.degree. C.
for the times indicated. Cell-associated counts are shown. Each
point represents the mean of 4 observations.+-.SEM when larger than
the symbol.
FIG. 6 shows the cellular accumulation of Tat peptide chelate conjugates
in KB-3-1 human tumor cells. KB-3-1 cells were incubated with compound
for 15 min at room temperature followed by a rapid wash and fixation:
fluorescein maleimide (0.5 .mu.M) alone (left) or Tat peptide chelate-fluorescein
maleimide conjugate (right). Tat peptide chelate was conjugated
with fluorescein maleimide on the C-terminal Cys residue. There
was no counter staining of nuclei with propidium iodide in this
example. Note the distribution of fluorescence from labeled peptide
conjugate corresponding to cytosolic and nuclear (nucleolar) distribution.
Bar=5 .mu.m.
FIG. 7 shows RP-HPLC traces (440 nm) of cell lysates from control
untreated Jurkat cells without added Tat peptide (A), untreated
Jurkat cells incubated in fluorescein tagged Tat peptide (B), and
ceramide-treated caspase-3 activated cells incubated in fluorescein
tagged Tat peptide (C). The intact fluorescein tagged Tat peptide
is seen in tracing B (arrow at R.sub.t=33.5 min). In tracing C,
note the absence of the intact Tat peptide. All three tracings show
autofluorescent compounds present in the cells at R.sub.t=22 and
28 min.
FIG. 8 shows scintigraphic image of rapid renal excretion of a
Tc-99m-Tat peptide in a normal FVB mouse 30 minutes post injection.
Following metofane anesthesia, Tc-99m-Tat chelate (200 .mu.Ci, prepared
as described in the application) was administered by tail vein injection
and the mouse immediately positioned for imaging on a gamma scintillation
camera (Siemens Basicam; 5 mm pinhole collimator; 20% energy window
centered over 140 keV). Sequential posterior images of the mouse
were collected at one frame/minute for .about.30 min with a 128.times.128
matrix. A [mal 5 minute acquisition with a 256.times.256 matrix
was also obtained. Images were corrected for radioactive decay,
but no corrections were made for scatter or attenuation. While radioactivity
initially distributed throughout the body, note focal radioactivity
within the urinary bladder after only 30 minutes, reflecting rapid
renal excretion of the Tat peptide conjugate.
FIG. 9 shows scintigraphic images of organ distribution of caspase-3-cleavable
Tc-99m-Tat peptide in FVB mice 30 minutes post injection. Using
a published procedure (Blankenberg, et al., Proc Natl Acad Sci USA
95:6349-6354, 1998), FVB mice were administered purified hamster
anti-Fas mAb (Jo2, PharMingen; 8 .mu.g/animal) by i.v. injection
and allowed to recover for 45 minutes prior to imaging. Following
metofane anesthesia, Tc-99m-Tat chelate (200 .mu.Ci, prepared as
described in the text) was administered by tail vein injection and
mice immediately positioned for imaging on a gamma scintillation
camera (Siemens Basicam; 5 mm pinhole collimator; 20% energy window
centered over 140 keV). Sequential posterior images of mice were
collected at one frame/minute for .about.30 min with a 128.times.128
matrix. A final 5 minute acquisition with a 256.times.256 matrix
was also obtained. Images were corrected for radioactive decay,
but no corrections were made for scatter or attenuation. Left, untreated
control mouse; right, mouse pre-treated with anti-Fag mAb. Note
focal radioactivity only in the urinary bladder of the control mouse,
but abundant retention of radioactivity in the pre-treated animal
within the liver and kidneys, two organs that express the Fas receptor
wherein caspase-mediated apoptosis is induced and imaged.
FIG. 10 shows comparative uptake of D, L and mixed D/L [.sup.99mTc]Tat-peptide
chelate conjugates. Net, 20 minute accumulation values into Jurkat
cells are shown. Each bar represents the mean of 4 observations+SEM.
(1) L/L, [.sup.99mTc]Tat-peptide conjugate 2; (2) L/D [.sup.99mTc]Tat-peptide
conjugate 5; (3) D/D [.sup.99mTc]Tat-peptide conjugate 9; and (4)
D/L [.sup.99mTc]Tat-peptide conjugate 12.
DETAILED DESCRIPTION OF THE INVENTION
The following detailed description is provided to aid those skilled
in the art in practicing the present invention. Even so, this detailed
description should not be construed to unduly limit the present
invention as modifications and variations in the the embodiments
discussed herein can be made by those of ordinary skill in the art
without departing from the spirit or scope of the present inventive
discovery.
All publications, patents, patent applications and other references
cited in this application are herein incorporated by reference in
their entirety as if each individual publication, patent, patent
application or other reference were specifically and individually
indicated to be incorporated by reference.
As used herein, the term "animal" includes, but is not
limited to, mammals, including human beings. It should be noted
that the complexes and methods disclosed herein are applicable in
both human and veterinary medicine. Thus, the present compounds
and methods can be applied to humans, domestic pets such as cats,
dogs, rodents, birds etc., farm animals such as cows, sheep, goats,
pigs, horses, etc., zoo animals, etc.
Amino acids are indicated herein using the single letter notation
conventional in the art. When used in amino acid sequences, the
letter "x" designates any amino acid. When used in an
amino acid sequence, a "/` between two adjacent letters indicates
that either of the amino acids listed can be used. When used in
nucleotide sequences, the letter "n" designates A, T,
C or G.
Structure of Membrane-Permeant Peptide Covalent and Coordination
Complexes
The general structure of the present invention compounds comprises
a unique combination of peptide components to produce a new class
of imaging and therapeutic conjugates that will enable interrogation
of, and/or interaction with, the desired intracellular processes
within living cells in the whole organism. This novel class of agents
in its simplest form comprises three components: 1) a cell membrane-permeant
peptide sequence made up of D-amino acids, L-amino acids or a combination
of D- and L-amino acids; 2) a functional or non-functional linker
motif; and 3) a chelator moiety able to coordinate metals useful
in medical imaging and therapy (FIG. 1), or other cargo molecule
such as a diagnostic substance or pharmaceutically active agent.
The HIV-1 Tat basic peptide sequence is an example of the prototypic
cell membrane-permeant component. The linker region can comprise
amino acid residues, or substituted or unsubstituted hydrocarbon
chains useful for connecting the Tat peptide and the metal chelator,
for example, via peptide bonds. The linker region can be designed
to be non-functional or functional. "Non-functional" refers
to non-reactive hydrocarbon chains, simple amino acid sequences,
or other sequences that simply bind covalently to the Tat peptide
residues on one end and the cargo molecule on the other end. A "functional
linker" can comprise amino acid residues that confer biological
properties useful for imaging, diagnostics, therapy, etc. Such a
functionality could include peptide or protein binding motifs, protein
kinase consensus sequences, protein phosphatase consensus sequences,
or protease-reactive or protease-specific sequences. Protease sequences
are particularly useful as they will result in amplification of
an imaging, radiotherapeutic, diagnostic, or therapeutic effect
through enzymatic action on the conjugate complex, thereby increasing
the intracellular concentration of a cleaved and subsequently trapped
metal-chelate or other cargo molecule.
Cell Membrane-Permeant Peptides
The cell membrane-permeant basic peptide component of the complexes
of the present invention can comprise any amino acid sequence that
confers the desired intracellular translocation and targeting properties
to the covalent or coordination complexes. Preferably, these amino
acid sequences are characterized by their ability to confer transmembrane
translocation and internalization of a complex construct when administered
to the external surface of an intact cell, tissue or organ. The
complex would be localized within cytoplasmic and/or nuclear compartments
as demonstrated by a variety of detection methods such as, for example,
fluorescence microscopy, confocal microscopy, electron microscopy,
autoradiography, or immunohistochemistry.
Cell membrane-permeant peptide sequences useful in practicing the
present invention include, but are not limited to, RQARRNRRRRWRERQR-51
(HIV-1 Rev protein basic motif; SEQ ID NO: 1); MPKTRRRPRRSQRKRPPTP-119
(HTLV-1 Rex protein basic motif; SEQ ID NO: 2) (Kubota et al., Biochem.
Biophys. Res. Comm., 162:963-970, 1989); the third helix of the
homeodomain of Antennapedia (Derossi, et al., J. Biol. Chem. 271:18188-93,
1996) (43-RQILIWFQNRRMKWLL-58 (SEQ ID NO: 3)); a peptide derivable
from the heavy chain variable region of an anti-DNA monoclonal antibody
(Avrameas, et al., Proc. Natl. Acad. Sci. 95:5601-06, 1998) (VAYISRGGVSTYYSDTVKGRFTRQKYNKRA
(SEQ ID NO: 4)); and the Herpes simplex virus YP22 protein (Elliot
and O'Hare, Cell, 88:223-33, 1997) (1-MTSRRSVKSGPREVPRDEYEDLYYTPSSGMASPDSPPDTSRRGALQTRSRQRG
EVRFVQYDESDYALYGGSSSEDDEHPEVPRTRRPVSGAVLSGPGPARAPPPPA GSGGAGRTPTTAPRAPRTQRVATKAPAAPAAETTRGRKSAQPESAALPDAPA
SRAPTVQLWQMSRPRTDEDLNELGITHRVTVCEGKNLLQRANELVNPDVV QDVDAATATRGRSAASRPTERPRAPARSASRPRRPVE-246
(SEQ ID NO: 5)). In a preferred embodiment, the basic peptide is
derivable from the human immunodeficiency virus type 1 (HIV-1) Tat
protein (Fawell et al., Proc. Natl. Acad. Sci., 91:664-68, 1994).
In particular, the Tat peptide can comprise any sequential residues
of the Tat protein basic peptide motif 37-72 (Vives et al., J. Biol.
Chem., 272:16010-16017, 1997) (37-CFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQ-72
(SEQ ID NO: 6). The minimum number of amino acid residues can be
in the range of from about three to about nine, preferably from
about three to about five, and most preferably about four, i.e.,
the minimal requirement for one alpha helical turn. A preferred
embodiment comprises Tat protein residues 48-57 (GRKKRRQRRR) (SEQ
ID NO: 7). In one preferred embodiment any of the aforementioned
membrane peptides may contain at least one D-amino acid. In another
preferred embodiment, a majority of the amino acid residues in any
of the aforementioned peptides can comprise D-amino acids. In yet
another preferred embodiment, any of the aforementioned peptides
are comprised entirely of D-amino acids in forward sequence or inverse
sequence (retro-inverse).
As used herein, the term "amino acid" is applicable not
only to cell membrane-permeant peptides, but also to linker moieties,
coordination ligands, and other cargos, including pharmaceutical
agents, i.e., all the individual components of the present complexes.
The term "amino acid" is used in its broadest sense, and
includes naturally occurring amino acids as well as non-naturally
occurring amino acids, including amino acid analogs and derivatives.
The latter includes molecules containing an amino acid moiety. One
skilled in the art will recognize, in view of this broad definition,
that reference herein to an amino acid includes, for example, naturally
occurring proteogenic L-amino acids; D-amino acids; chemically modified
amino acids such as amino acid analogs and derivatives; naturally
occurring non-proteogenic amino acids such as norleucine, .beta.-alanine,
ornithine, etc.; and chemically synthesized compounds having properties
known in the art to be characteristic of amino acids. As used herein,
the term "proteogenic" indicates that the amino acid can
be incorporated into a peptide, polypeptide, or protein in a cell
through a metabolic pathway.
The incorporation of non-natural amino acids, including synthetic
non-native amino acids, substituted amino acids, or one or more
D-amino acids into the peptides (or other components of the complexes)
of the present invention (subsequently referred to herein as "D-peptides")
is advantageous in a number of different ways. D-amino acid-containing
peptides exhibit increased stability in vitro or in vivo compared
to L-amino acid-containing counterparts. Thus, the construction
of peptides incorporating D-amino acids can be particularly useful
when greater intracellular stability is desired or required. More
specifically, D-peptides are resistant to endogenous peptidases
and proteases, thereby providing better oral transepithelial and
transdermal delivery of linked drugs and conjugates, improved bioavailability
of membrane-permeant complexes, and prolonged intravascular and
interstitial lifetimes when such properties are desirable. The use
of D-peptides can also enhance transdermal and oral transepithelial
delivery of linked drugs and other cargo molecules. As shown in
Example 14, the use of D-amino acids in the membrane permeant peptide
greatly increases the accumulation of linked drugs or other cargo
molecules into cells. Additionally, D-peptides cannot be processed
efficiently for major histocompatibility complex class II-restricted
presentation to T helper cells, and are therefore less likely to
induce humoral immune responses in the whole organism. Peptide conjugates
can therefore be constructed using, for example, D-peptide membrane
permeant sequences, L-peptide functional linker domains, and D-peptide
chelation sequences. In this embodiment, only the functional L-peptide
linker region would be able to interact with native enzymatic activities
such as proteases, kinases, and phosphatases, thereby providing
enhanced selectivity, prolonged biological half-life, and improved
signal-to-noise ratio for selected imaging applications. On the
other hand, when it is more desirable to allow the peptide to remain
active for only a short period of time, the use of L-amino acids
in the peptide can allow endogenous peptidases in a cell to digest
the peptide in vivo, thereby limiting the cell's exposure to the
membrane-permeant peptide covalent and coordination complexes comprising
the peptides disclosed herein. It will be apparent that it is possible
to construct complexes in which different portions contain either
D- or L-amino acids. For example and without limitation, it is possible
to construct a complex in which a cell permeant peptide and a metal
chelator comprised of D-amino acids are connected by a functional
linker comprised of L-amino acids. Other such combinations will
be readily apparent to those of ordinary skill in the art and are
within the scope of the present invention.
In addition to using D-amino acids, those of ordinary skill in
the art are aware that modifications in the amino acid sequence
of a peptide, polypeptide, or protein can result in equivalent,
or possibly improved, second generation peptides, etc., that display
equivalent or superior functional characteristics when compared
to the original amino acid sequence. The present invention accordingly
encompasses such modified amino acid sequences. Alterations can
include amino acid insertions, deletions, substitutions, truncations,
fusions, inversions, shuffling of subunit sequences, and the like,
provided that the peptide sequences produced by such modifications
have substantially the same functional properties as the naturally
occurring counterpart sequences disclosed herein. Thus, for example,
modified cell membrane-permeant peptides should possess substantially
the same transmembrane translocation and internalization properties
as the naturally occurring counterpart sequence.
One factor that can be considered in making such changes is the
hydropathic index of amino acids. The importance of the hydropathic
amino acid index in conferring interactive biological function on
a protein has been discussed by Kyte and Doolittle (J. Mol. Biol.,
157: 105-132, 1982). It is accepted that the relative hydropathic
character of amino acids contributes to the secondary structure
of the resultant protein. This, in turn, affects the interaction
of the protein with molecules such as enzymes, substrates, receptors,
DNA, antibodies, antigens, etc.
Based on its hydrophobicity and charge characteristics, each amino
acid has been assigned a hydropathic index as follows: isoleucine
(+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine
(+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine
(-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline
(-1.6); histidine (-3.2); glutamate/glutamine/aspartate/asparagine
(-3.5); lysine (-3.9); and arginine (-4.5).
As is known in the art, certain amino acids in a peptide or protein
can be substituted for other amino acids having a similar hydropathic
index or score and produce a resultant peptide or protein having
similar biological activity, i.e., which still retains biological
functionality. In making such changes, it is preferable that amino
acids having hydropathic indices within .+-.2 are substituted for
one another. More preferred substitutions are those wherein the
amino acids have hydropathic indices within .+-.1. Most preferred
substitutions are those wherein the amino acids have hydropathic
indices within .+-.0.5.
Like amino acids can also be substituted on the basis of hydrophilicity.
U.S. Pat. No. 4,554,101 discloses that the greatest local average
hydrophilicity of a protein, as governed by the hydrophilicity of
its adjacent amino acids, correlates with a biological property
of the protein. The following hydrophilicity values have been assigned
to amino acids: arginine/lysine (+3.0); aspartate/glutamate (+3.0.+-.1);
serine (+0.3); asparagine/glutamine (+0.2); glycine (0); threonine
(-0.4); proline (-0.5.+-.1); alanine/histidine (-0.5); cysteine
(-1.0); methionine (-1.3); valine (-1.5); leucine/isoleucine (-1.8);
tyrosine (-2.3); phenylalanine (-2.5); and tryptophan (-3.4). Thus,
one amino acid in a peptide, polypeptide, or protein can be substituted
by another amino acid having a similar hydrophilicity score and
still produce a resultant protein having similar biological activity,
i.e., still retaining correct biological function. In making such
changes, amino acids having hydropathic indices within .+-.2 are
preferably substituted for one another, those within .+-.1 are more
preferred, and those within .+-.0.5 are most preferred.
As outlined above, amino acid substitutions in the peptides of
the present invention can be based on the relative similarity of
the amino acid side-chain substituents, for example, their hydrophobicity,
hydrophilicity, charge, size, etc. Exemplary substitutions that
take various of the foregoing characteristics into consideration
in order to produce conservative amino acid changes resulting in
silent changes within the present peptides, etc., can be selected
from other members of the class to which the naturally occurring
amino acid belongs. Amino acids can be divided into the following
four groups: (1) acidic amino acids; (2) basic amino acids; (3)
neutral polar amino acids; and (4) neutral non-polar amino acids.
Representative amino acids within these various groups include,
but are not limited to: (1) acidic (negatively charged) amino acids
such as aspartic acid and glutamic acid; (2) basic (positively charged)
amino acids such as arginine, histidine, and lysine; (3) neutral
polar amino acids such as glycine, serine, threonine, cysteine,
cystine, tyrosine, asparagine, and glutamine; and (4) neutral non-polar
amino acids such as alanine, leucine, isoleucine, valine, proline,
phenylalanine, tryptophan, and methionine. It should be noted that
changes which are not expected to be advantageous can also be useful
if these result in the production of functional sequences.
Since small peptides can be easily produced by conventional solid
phase synthetic techniques, the present invention includes peptides,
linker regions, and cargo molecules such as those discussed herein,
containing the amino acid modifications discussed above, alone or
in various combinations. To the extent that such modifications can
be made while substantially retaining the cell membrane permeant
and targeting properties of the peptide, and the biological function
and specificity of the linker region and cargo moieties, they are
included within the scope of the present invention. The utility
of such modified peptides, linkers, and cargos can be determined
without undue experimentation by, for example, the methods described
in the examples below.
Linker Regions
Linker regions useful in linking the Tat or other cell membrane-permeant
peptides described herein and cargos such as drugs or diagnostic
substances such as metal chelator moieties can comprise amino acid
residues or substituted or unsubstituted hydrocarbon chains. Useful
linker regions include natural and unnatural biopolymers. Examples
of natural linkers include oligonucleotides and L-oligopeptides,
while examples of unnatural linkers are D-oligopeptides, lipid oligomers,
liposaccharide oligomers, peptide nucleic acid oligomers, polylactate,
polyethylene glycol, cyclodextrin, polymethacrylate, gelatin, and
oligourea (Schilsky, et al., Eds., Principles of Antineoplastic
Drug Development and Pharmacology, Marcel Dekker, Inc., New York,
1996, pp. 741). The linker region can be designed to be functional
or non-functional.
"Non-functional" as applied to linker regions means any
non-reactive amino acid sequence, hydrocarbon chain, etc., that
can bond covalently to Tat or other cell membrane-permeant peptide
residues on one end and a drug or chelating ligand, for example,
on the other end. As used herein, the term "non-reactive"
refers to a linker that is biologically inert and biologically stable
when a complex containing the linker is contacted by cells or tissues.
Upon characterization, the linker and conjugate can be shown to
remain intact as the parent compound when analyzed by reverse phase
HPLC or TLC. Non-functional linkers are desirable in the design
and synthesis of complexes useful, for example, in non-specific
labeling of white blood cells for imaging infections, in non-specific
labeling of tissues for perfusion imaging, and in interaction with
any intracellular receptor or other activity or site. Examples of
non-functional linkers include, but are not limited to, amino hexanoic
acid, glycine, alanine, or short peptide chains of nonpolar amino
acids such as di- or tri-glycine or tri-alanine. Hydrocarbon chain
linkers can include both unsubstituted and substituted alkyl, aryl,
or macrocyclic R groups, as disclosed in U.S. Pat. No. 5,403,574.
R groups are found in the general formula --CR.sub.3 where R can
be identical or different and includes the elements H, C, N, O,
S, F, Cl, Br, and I. Representative examples include, but are not
limited to, --CH.sub.3, --CH.sub.2CH.sub.3, --CH(CH.sub.3).sub.2,
--C(CH.sub.3).sub.3, --C(CH.sub.3).sub.2, --OCH.sub.3, --C(CH.sub.3).sub.2,
--COOCH.sub.3, --C(CH.sub.3).sub.2OCOCH.sub.3, CONH.sub.2, --C.sub.6H.sub.5,
--CH.sub.2(C.sub.6H.sub.4)OH, or any of their isomeric forms. "Alkyl"
is intended to mean any straight, branched, saturated, unsaturated
or cyclic C.sub.1-20 alkyl group. Typical C.sub.1-C.sub.20 alkyl
groups include, but are not limited to, methyl, ethyl, n-propyl,
i-propyl, n-butyl, t-butyl, i-butyl, pentyl and hexyl groups. "Aryl"
is intended to mean any aromatic cyclic hydrocarbon based on a six-membered
ring. Typical aryl groups include, but are not limited to, phenyl,
naphthyl, benzyl, phenethyl, phenanthryl, and anthracyl groups.
The term "macrocycle" refers to R groups containing at
least one ring containing more than seven carbon atoms. "Substituted"
is intended to mean any alkyl, aryl or macrocyclic groups in which
at least one carbon atom is covalently bonded to any functional
groups comprising the atoms H, C, N, O, S, F, Cl, Br or I.
"Functional" as applied to linker regions means, for
example, amino acid residues, oligonucleotides, oligosaccharides,
peptide nucleic acids, or substituted or unsubstituted hydrocarbon
chains as discussed above that confer biological or physicochemical
properties useful for the practice of this invention when incorporated
into the linker component. Such properties include, for example,
utility in medical imaging, radiotherapy, diagnosis, and pharmacological
treatment of disease states by virtue of interaction of the functional
linker region with intracellular components, which can be unique
to, or highly characteristic of, cells in particular physiological
or disease states. Such interaction can include, for example, binding
or other reaction, for example cleavage, of the functional linker
region due to interaction with intracellular components. However
this interaction occurs, such interaction results in selective retention
of the cargo molecule within particular cells due to the presence
of a particular intracellular component(s) within such cells. The
interaction of the functional linker with the intracellular component
thereby confers target cell specificity to a peptide complex containing
a particular functional linker moiety. Examples of functional linkers
are peptide or protein binding motifs, protein kinase consensus
sequences, protein phosphatase consensus sequences, or protease-reactive
or protease-specific sequences. Additional examples include recognition
motifs of exo- and endo-peptidases, extracellular metalloproteases,
lysosomal proteases such as the cathepsins (cathepsin B), HIV proteases,
as well as secretases, transferases, hydrolases, isomerases, ligases,
oxidoreductases, esterases, glycosidases, phospholipases, endonucleases,
ribonucleases and .beta.-lactamases.
Specific examples of useful consensus sequences and recognition
motifs are: 14-3-3 protein binding motifs such as RSXSphosphoSXP
(SEQ ID NO: 8) or RXY/FXphosphoSXP (SEQ ID NO: 9) (Yaffe et al.,
Cell, 91:961-971, 1997). Preferred embodiments include the 14-3-3
protein binding motifs RLSHphosphoSLP (SEQ ID NO: 10), RLYHphosphoSLP
(SEQ ID NO: 11) (Peng, et al., Science 277:1501-1505, 1997); and
RLSHphosphoSLG (SEQ ID NO: 12). Protease-reactive or specific consensus
sequences include, for example, those peptide sequences recognized
by interleukin-1.beta. converting enzyme (ICE) homologues, such
as caspase-1, CPP32/Yama/apopain/caspase-3, NEDD2/Ich-1/caspase-2,
TX/Ich-2/caspase-4, ICE-LAP3/MCH-3/CMH-1/caspase-7, ICE-LAP6/caspase-9,
and FLICE/MACH/caspase-8 ((Nakagawara et al. Cancer Res., 57:4578-4584,
1997) and references therein), including YEVDx (SEQ ID NO: 13) for
Caspase-1, YDVADx (SEQ ID NO: 14) for Caspase-2, DEVDx (SEQ ID NO:
15) and DMQDx (SEQ ID NO: 16) for Caspase-3, LEVDx ((SEQ ID NO:
17) for Caspase-4, VEIDx (SEQ ID NO: 18) for Caspase-6, DEVDx (SEQ
ID NO: 19) for Caspase-7, IETDx (SEQ ID NO: 20) for Caspase-8, and
IEADx (SEQ ID NO: 21) for Caspase-10 (Villa, et al., Trends Biochem
Sci 22:388-393, 1997); SQVSQNY-PIVQNLQ (SEQ ID NO: 22) for the HIV
p17-p24 A cleavage site, and CTERQAN-FLGKIWP (SEQ ID NO: 23) for
the HIV p7-p1 D cleavage site (Ratner, et al., Nature 313:277-284,
1985; Welch, et al., Proc Natl Acad Sci USA 88:10792-10796, 1991);
xR(R/K)x(S/T)x for Protein Kinase A, x(R/K).sub.2-3x(S/T)x for Protein
Kinase G, X(R/K.sub.1-3,x.sub.0-2)(S/T)(X.sub.0-2,R/K.sub.1-3)x
for Protein Kinase C, xRxx(S/T)x for Calmodulin Kinase II, KRKQI(S/T)VR
(SEQ ID NO: 24) for Phosphorylase b Kinase, TRDIYETDYYRK (SEQ ID
NO: 25) for Insulin Receptor Kinase, and TAENAEYLRVAP (SEQ ID NO:
26) for EGF Receptor Kinase (Kemp and Pearson, Trends Biochem Sci
15:342-346, 1990; Kennelly and Krebs, J Biol Chem 266:15555-15558,
1991). Examples of other useful non-peptide motifs include, for
example, DNA recognition sequences such as 3'-TCTTGTnnnACAAGA-5'
(SEQ ID NO: 27) for the glucocorticoid hormone response element,
3'-TCCAGTnnnACTGGA-5' (SEQ ID NO: 28) for the estrogen receptor
response element, and 3'-TCCAGTACTGGA-5' (SEQ ID NO: 29) for the
thyroid hormone response element (Fuller, FASEB J 5:3092-3099, 1991).
Additional sequences known to those skilled in the art and available
by reference to public databases can be incorporated into the linker
moieties of the present complexes. Well known protein, DNA, and
RNA databases available to investigators working in the art of biomedical
and pharmaceutical sciences include those linked to the U.S. National
Institutes of Health Web Site, such as: http://molbio.info.nih.gov/molbio/,
all herein incorporated by reference. A biomolecule or fragment
thereof containing a putative recognition motif can be identified
by sequence comparison of the primary structure with a primary consensus
sequence or individual sequence of a protein or biomolecule in the
databases using routine computerized sequence scanning methods such
as, for example, BLAST.
When incorporated into the intact Tat or other peptide complexes
of the present invention, such sequence motifs will be acted on
solely or selectively in those cells containing the appropriate
intracellular sequence-specific or sequence-reactive protein, which
will alter the intracellular/subcellular distribution and retention
of the cargo molecule, e.g., a drug or metal chelate. For example,
protease sequences are particularly useful as they result in enzymatic
amplification of an imaging or radiotherapeutic effect through enzymatic
action on the conjugate complex, thereby cleaving and subsequently
trapping metal-chelates within intracellular compartments, leading
to an increase in the concentration of the metal-complex fragment.
To further illustrate this principle, if the intracellular target
to be detected is a specific protease activity of the caspase family,
then when a coordination complex of the present invention comprising
the components (Tat peptide)-(caspase-3 motif linker)-(chelate{metal})
translocates into a cell containing caspase-3, the enzyme will cleave
the complex in the linker region, thereby releasing the metal-chelate
within the cell interior, which can then be monitored by conventional
techniques.
Cells or tissues having other biological, biochemical, or physiological
activities can also be detected when the appropriate functional
linker is incorporated into the covalent or coordination complex.
For example, a hexose sequence recognized by .beta.-galactosidase
can be synthesized into the linker region of the invention compounds,
e.g., as (Tat peptide)-(D-galactose-D-glucose)-(chelate{metal}).
Then, upon administration to cells transduced with a marker gene
that encodes .beta.-galactosidase, for example in gene therapy,
only those cells which express .beta.-galactosidase will cleave
and retain the chelate-metal complex for subsequent detection by
external imaging devices.
Metal-chelate moieties can be synthesized to possess net charge,
for example, by substitution of K for G on the eKGC chelation peptide
as illustrated in Example 1. This is useful for in vivo applications
in a whole animal. Because non-targeted or unreacted Tat peptide
conjugates are capable of bidirectionally translocating across membranes,
as the extracellular concentration of a Tat peptide conjugate declines,
the intracellular intact Tat peptide conjugate will translocate
outwardly and be cleared from the animal via the bloodstream. However,
where protease cleavage acts on the peptide, the Tat fragment is
separated from the chelate fragment, which further generates a positive
charge at the amino-terminus of the cleaved chelate fragment. Thus,
the overall charge of the released peptide chelate complex will
be polycationic. This cluster of charge combined with the lack of
an attached Tat permeation sequence will render the cleaved chelate
fragment impermeant to the cell membrane, in effect trapping the
chelate fragment within the cell both in vivo and in vitro. In cells
lacking the targeted protease activity, the intact Tat peptide-chelate
complex translocates outwardly into the extracellular spaces as
the extracellular concentration of the Tat peptide decreases. This
clearance has been found to occur surprisingly rapidly in vivo.
The present invention exploits this high clearance rate to provide
high target-to-background ratios for imaging, diagnostics, and therapeutic
delivery of metal chelates and drug conjugates to specific cells,
tissues and organs.
In cases where the metal-chelate comprises a radioactive metal,
then external imaging devices such as scintigraphic gamma cameras
or SPECT will only detect high radioactivity within cells, tissues
or organs containing the desired biological activity. In contrast,
if the metal-chelate comprises a ligand complexed with a relaxivity
metal, such as Gd-DTPA, then the resulting enhanced T1 relaxivity
would be detectable within cells and tissues of living patients
using appropriate T1-weighted pulse sequences generated by clinical
magnetic resonance imaging (MRI) devices. Those skilled in the art
can readily operate the appropriate MRI device to detect proton
relaxivity changes in bodily water induced by relaxivity complexes
known as MR contrast agents (Stark and Bradley, Magnetic Resonance
Imaging, C.V. Mosby Co., St. Louis, 1988, pp. 1516). Thus, the present
invention overcomes a limitation present in existing methods, which
do not provide for the intracellular deposition of peptide chelate-metal
complexes for targeted medical imaging with SPECT/PET and radiotherapeutic
applications, nor allow the interrogation of changes in intracellular
proton relaxivity with MRI devices. In contrast, the present invention
provides for the intracellular delivery and targeted retention of
desired metal complexes.
Other variations are possible wherein the Tat or other peptide-linker-metal
complexes contain a functional linker and are sufficiently stable
to be delivered to the desired cells and translocated into the cell
interior, where they will be acted upon by the targeted intracellular
biochemical activity and the retained metal-chelates detected with
imaging devices as above.
In addition to radioactive and non-radioactive metals, pharmacologically
active substances, prodrugs, cytotoxic substances, and diagnostic
substances such as fluorochromes, dyes, enzyme substrates, etc.,
can be coupled to the linkers of the present membrane-permeant peptide
complexes. A wide variety of drugs are suitable for use with the
present invention, and include, for example, conventional chemotherapeutics,
such as vinblastine, doxorubicin, bleomycin, methotrexate, 5-fluorouricil,
6-thioguanine, cytarabine, cyclophosphamide, taxol, taxotere, cis-platin,
adriamycin, mitomycin, and vincristine as well as other conventional
chemotherapeutics as described in Cancer: Principles and Practice
of Oncology, 5th Ed., V. T. Devita, S. Hellman, S. A. Rosenberg,
J. B. Lippincott, Co., Phila, 1997, pp. 3125. Also suitable for
use in the present invention are experimental drugs, such as UCN-01,
acivicin, 9-aminocamptothecin, azacitidine, bromodeoxyuridine, bryostatin,
carboplatin, dideoxyinosine, echinomycin, fazarabine, hepsulfam,
homoharringtonine, iododeoxyuridine, leucovorin, merbarone, misonidazole,
pentostatin, semustine, suramine, mephthalamidine, teroxirone, triciribine
phosphate and trimetrexate as well as others as listed in NCI Investigational
Drugs, Pharmaceutical Data 1994, NIH Publications No. 94-2141, revised
January 1994.
Other useful drugs include anti-inflammatories such as Celebrex,
indomethacin, flurbiprofen, ketoprofen, ibuprofen and phenylbutazone;
antibiotics such as beta-lactams, aminoglycosides, macrolides, tetracyclines,
pryridonecarboxylic acids and phosphomycin; amino acids such as
ascorbic acid and N-acetyltryptophan; antifungal agents; prostaglandins;
vitamins; steroids; and antiviral agents such as AZT, DDI, acyclovir,
gancyclovir, idoxuridine, amantadine and vidarabine.
Pharmacologically active substances that can be conjugated to the
complexes of the present invention include, but are not limited
to, enzymes such as transferases, hydrolyses, isomerases, proteases,
ligases, kinases, and oxidoreductases such as esterases, phosphatases,
glycosidases, and peptidases; enzyme inhibitors such as leupeptin,
chymostatin and pepstatin; and growth factors.
In addition, the present invention can be used to deliver fluorochromes
and vital dyes into cells. Examples of such fluorochromes and vital
dyes are well known to those skilled in the art and include, for
example, fluorescein, rhodamine, coumadin, indocyanine Cy 5.5, NN382,
Texas red, DAPI and ethidium bromide.
The delivery of drug and pharmacologically active compounds into
the cell interior can be enhanced by direct conjugation to the Tat
or other membrane-permeant peptides of the present invention. The
coupling of such compounds to a functional linker placed between
a D-amino acid containing cell membrane-permeant peptide and the
active agent, thereby enabling enhanced, functionally selective,
intracellular trapping of the drug or drug conjugate, is new. A
drug or prodrug conjugate designed as described herein would enable
selective delivery (and retention) of bioactive agents and therapeutic
or biologic enhancers useful in therapy including, but not limited
to, granulocyte-stimulating factors, platelet-stimulating factors,
erythrocyte-stimulating factors, macrophage-colony stimulating factors,
interleukins, tumor necrosis factors, interferons, other cytokines,
monoclonal antibodies, immune adjuvants and gene therapy vectors
(Devita, et al., Biologic Therapy of Cancer, 2nd Ed., J. B. Lippincott,
Co., Phila, 1995, pp. 919), and drugs into the cell interior in
a manner analogous to the selective trapping of metal chelates as
described above. Linker functionality can include any motif that
can be acted on by a specific intracellular agent, such as the enzymes
discussed above, or ribozymes, for example. Examples of such linker
functionalities include low molecular weight peptide or protein
binding motifs, protein kinase consensus sequences, protein phosphatase
consensus sequences, or protease-specific sequences. As explained
previously, protease-reactive or protease-specific sequences are
particularly useful in that amplification of the therapeutic effect
would occur through enzymatic action on the linker region of the
drug or prodrug conjugate, thereby releasing the pharmacological
agent in the cell cytosol, and increasing the intracellular retention
and concentration of the agent.
Pharmacologically active substances, cytotoxic substances, diagnostic
substances, etc., can be coupled to the appropriate cell membrane-permeant
peptide-linker conjugate through either the amino- or carboxy-terminus
of the linker region in a manner analogous to that described in
Example 1. For example, drug conjugates wherein the carboxy-terminus
of the peptide linker is coupled to a bioactive substance can be
prepared by the use of an active ester of the desired bioactive
substance in the presence of a dehydrating agent. Examples of active
esters that can be used in the practice of the present invention
include the hemi-succinate esters of N-hydroxysuccinimide, sulfo-N-hydroxy-succinimide,
hydroxybenzotriazole, and p-nitrophenol. Dehydration agents include
dicyclohexylcarbodiimide (DCC), 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide
(ECD), and 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide methiodide
(EDCI). The use of ECD to form conjugates is disclosed in U.S. Pat.
No. 4,526,714, the disclosure of which is fully incorporated by
reference herein. Other examples of coupling reagents include glutathione,
3-(diethoxyphosphoryloxy)-1,2,3-benzotriazin-4(3H)-one (DEPBT),
onium salt-based coupling reagents, polyoxyethylene-based heterobifunctional
cross-linking reagents, and other reagents that facilitate the coupling
of organic drugs and peptides to various ligands (Haitao, et al.,
Organ Lett 1:91-94, 1999; Albericio, et al., J Organic Chemistry
63:9678-9683, 1998; Arpicco, et al., Bioconjugate Chem 8:327-337,
1997; Frisch, et al., Bioconjugate Chem 7:180-186, 1996; Deguchi,
et al., Bioconjugate Chem 10:32-37, 1998; Beyer, et al., J Med Chem
41: 2701-2708, 1998; Dirven, et al., Chem Res Toxicol 9:351-360,
1996; Drouillat, et al., J Pharm Sci 87:25-30, 1998; Trimble, et
al., Bioconjugate Chem 8:416-423, 1997). Chemicals, reagents and
techniques useful in drug cross-linking and peptide conjugation
are disclosed in general texts well known to those skilled in the
art (Dawson, et al., (Eds.), Data for Biochemical Research, 3rd
Ed., Oxford University Press, Oxford, UK, 1986, pp. 580; King, (Ed.),
Medicinal Chemistry: Principles and Practice, Royal Society of Chemistry,
Cambridge, UK, 1994, pp. 313; Shan and Wong, (Eds.), Chemistry of
Protein Conjugation and Cross-Linking, CRC Press, Boca Raton, 1991,
pp. 328). Additional chemical coupling agents are described in U.S.
Pat. No. 5,747,641, hereby incorporated by reference in its entirety.
Conjugated Chelate Ligands and Drugs
The present invention also encompasses the use of chelation ligands
to form coordinate bonds with desired metals. The desired chelation
ligands are attached to the peptide conjugate where they bind radionuclides
and desired non-radioactive metals in a highly efficient and stable
manner. When the metal is a radionuclide, this allows the reporting
of the spatial location of the conjugate with external imaging devices
such as SPECT and PET detectors following administration of the
conjugate to an animal. As disclosed above, preferred embodiments
of the present invention permit the chelation moiety to be concentrated
within cellular and tissue compartments in proportion to specific
enzymatic or protein activities present in the cells therein. In
other preferred embodiments, where the metal is a selected therapeutic
radionuclide, the present invention allows the chelation moiety
to be concentrated within target cellular and tissue compartments
in proportion to a specific enzymatic or protein activity to deposit
radiation selectively within the target cell or tissue. In another
preferred embodiment, when the metal is a relaxivity metal, the
chelation moiety permits magnetic resonance imaging of the cell
or tissue. Alternatively, when the functional linker region of the
permeant peptide construct is conjugated to a drug, the drug will
be selectively deposited within the target cell or tissue by methods
of this invention.
Suitable chelation ligands are well known to those skilled in the
art and include, but are not limited to, diethylenetriaminepentaacetic
acid (DTPA), ethylenediaminetetraacetic acid (EDTA), tetraazacyclododecanetetraacetic
acid (DOTA), and other chelators that incorporate electron donating
atoms such as O, S, P or N as Lewis bases to bind the metal (Engelstad
and Wolf, "Contrast Agents", in Magnetic Resonance Imaging,
Stark and Bradley, Mosby, St. Louis, 1988, pp. 161-181). The present
complexes can also employ chelating ligands such as, but not restricted
to, those containing N.sub.2S.sub.2, N.sub.3S, N.sub.2SO and NS.sub.3)
moieties (Meegalla et al., J. Med. Chem., 40:9-17, 1997). Specific
examples (as shown below) wherein these chelation moieties are incorporated
into specific sequences of peptide residues, such as E-amine modified
Lys-Gly-Cys tags, are especially convenient for synthesizing the
desired chelation groups directly into peptide-based sequences.
Preferred chelation ligands are peptides or modified peptides which
enable the chelation moiety to be incorporated into the peptide
construct directly by solid phase synthesis by use of appropriately
blocked peptide precursors compatible with commercial peptide synthesizers.
Examples of this preferred embodiment are illustrated below in more
detail. Alternatively, other preferred chelation ligands can be
chemically coupled to the peptide conjugate by use of one or more
of the linker reagents described above. Other preferred embodiments
of the invention encompass the conjugation of drugs to the functionalized
linker region attached to the permeant peptide. In one embodiment,
the chelation complexes of the present invention comprise a peptide-based
chelator wherein the coordination sites of the chelator are filled
with a metal useful in imaging or radiotherapy.
Radioactive and Non-Radioactive Metals
Useful metals for chelation into the complexes of the present invention
include radionuclides having decay properties that are amenable
for use as a diagnostic tracer or for deposition of medically useful
radiation within cells or tissues. The present invention consequently
encompasses the use of conjugated coordination complexes of a ligand
with a radioactive metal (radionuclide). The radioactive nuclide
can, for example, be selected from the group consisting of radioactive
isotopes of Tc, Ru, In, Ga, Co, Pt, Fe, Os, Ir, W, Re, Cr, Mo, Mn,
Ni, Rh, Pd, Nb, Cu and Ta, for example, Tc-99m, Tc-99, In-111, Ga-67,
Ga-68, Cu-64, Ru-97, Cr-51, Co-57, Re-188, and Re-186. Such complexes
can be used for medical imaging and specifically for SPECT or PET
imaging, as provided herein. Technetium-99m (Tc-99m; t 1/2=6 hours;
140 keV emission photon) is the most commonly used radionuclide
in diagnostic nuclear medicine (Jurisson et al., Chem. Rev., 93:1137-156,
1993). It can be readily produced by molybdenum-99/technetium-99m
generators available in clinical nuclear medicine radiopharmacy
laboratories, and has favorable emission characteristics that enable
ready detection with clinical gamma cameras. While the complexes
of the present invention preferably contain Tc-99m and the closely
related rhenium isotopes (Re-186 and Re-188), other radionuclides
and metals, in addition to those already listed, useful for imaging
and radiotherapy such as I-123, I-125, I-130, I-131, I-133, Sc-47,
As-72, Se-72, Y-90, Y-88, Pd-100, Rh-100m, Sb-119, Ba-128, Hg-197,
At-211, Bi-212, Pd-212, Pd-109, Cu-67, Br-75, Br-76, Br-77, C-11,
N-13, O-15, F-18, Pb-203, Pb-212, Bi-212, Cu-64, Ru-97, Rh-105,
Au-198, and Ag-199 are also encompassed within the scope of this
invention. Moreover, the general availability of supplies of pertechnetate
from a variety of vendors makes it convenient to use kits for preparation
of various pep |